Top 24 Best Antigens

 

PIGU Recombinant Protein Antigen 01 ml

PIGU Recombinant Protein Antigen, 0.1 ml

PIGU Recombinant Protein Antigen, 0.1 ml - Organism species homo sapiens (human). Sample type tissue homogenates, cell lysates and other biological fluids. Size 96t. Assay length 45hours. Type sandwich.

 

Tsta3 CT Tsta3 P35b Tstap35b GDP-L-fucose synthase GDP-4-keto-6-deoxy-D-mannose-35-epimerase-4-reductase Protein FX Red cell NADPH-binding protein Transplantation antigen P35B Tum-P35B antigen Biotin 043403-Biotin-200ul

Tsta3, CT (Tsta3, P35b, Tstap35b, GDP-L-fucose synthase, GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase, Protein FX, Red cell NADP(H)-binding protein, Transplantation antigen P35B, Tum-P35B antigen) (Biotin), 043403-Biotin-200ul

Tsta3, CT (Tsta3, P35b, Tstap35b, GDP-L-fucose synthase, GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase, Protein FX, Red cell NADP(H)-binding protein, Transplantation antigen P35B, Tum-P35B antigen) (Biotin), 043403-Biotin-200ul - Further dilutions can be made in assay buffer. Note applications are based on unconjugated antibody. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Dilute required amount only prior to immediate use. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Applications suitable for use in western blot, elisa recommended dilution elisa 11,000 western blot 1100-500 storage and stability store product at 4°c if to be used immediately within two weeks. Two step nadp-dependent conversion of gdp-4-dehydro-6-deoxy-d-mannose to gdp-fucose, involving an epimerase and a reductase reaction (by similarity). Aliquots are stable at -20°c for 12 months after receipt.

 

Colon Cancer Specific Antigen-4 CCSA-4 BioAssay™ ELISA Kit Rabbit 188984-96Tests

Colon Cancer Specific Antigen-4 (CCSA-4) BioAssay™ ELISA Kit (Rabbit), 188984-96Tests

Colon Cancer Specific Antigen-4 (CCSA-4) BioAssay™ ELISA Kit (Rabbit), 188984-96Tests - H influenzae b test latex one dropper bottle (pale blue cap). Strep b test latex one dropper bottle (pink cap). S pneumoniae test latex one dropper bottle (yellow cap). N meningitidis acy w135 test latex one dropper bottle (gray cap).

 

NOVA 1 RNA Binding Protein Euro-oncological ventral antigen 1 Neuro-oncological ventral antigen 1 Nova-1 Onconeural ventral antigen-1 Paraneoplastic Ri antigen Ventral neuron-specific protein 1

NOVA 1 RNA Binding Protein (Euro-oncological ventral antigen 1, Neuro-oncological ventral antigen 1, Nova-1, Onconeural ventral antigen-1, Paraneoplastic Ri antigen, Ventral neuron-specific protein 1)

NOVA 1 RNA Binding Protein (Euro-oncological ventral antigen 1, Neuro-oncological ventral antigen 1, Nova-1, Onconeural ventral antigen-1, Paraneoplastic Ri antigen, Ventral neuron-specific protein 1) - To identify nova rna targets, ule et al. Aliquots are stable for 12 months. Of the 35 proteins with known interaction partners, 26 (74%) interact with each other. By analyzing alternative splicing in brains of nova1 -/- and nova2 -/- mice, ule et al. Other applications not tested. The nova1 gene encodes a neuron-specific rna-binding protein that is inhibited by paraneoplastic antibodies (buckanovich et al. Of the 40 nova-spliced transcripts with defined brain function, 34 encoded proteins that act at the synapse (neurotransmitter receptors, cation channels, adhesion and scaffold proteins), and 8 encoded proteins involved in axon guidance. Storage and stability may be stored at 4°c for short-term only. Splicing targets confirmed in nova-null mice include c-jun n-terminal kinase-2 (602896), neogenin (601907), and gephyrin (603930) the last encodes a protein that clusters inhibitory gamma-aminobutyric acid and glycine receptors, 2 previously identified nova splicing targets. Thus, clip revealed that nova coordinately regulates a biologically coherent set of rnas encoding multiple components of the inhibitory synapse, an observation that may relate to the cause of abnormal motor inhibition in paraneoplastic opsoclonus myoclonus ataxia (poma). (2005) identified nova-dependent alternatively spliced transcripts. Recommended dilution elisa (serum titer) 162,500 optimal dilutions to be determined by the researcher. Three-quarters of these encode proteins that function at the neuronal synapse, and one-third are involved in neuronal inhibition. See also nova2 (601991). (2003) developed a method to purify protein-rna complexes from mouse brain using ultraviolet crosslinking and immunoprecipitation (clip). Thirty-four transcripts were identified multiple times by nova clip. , 1996). Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial. Applications suitable for use in elisa and immunohistochemistry. Store at -20°c.

 

Prostate Specific Antigen PSA BioAssay™ ELISA Kit Guinea Pig 202366-96Tests

Prostate Specific Antigen (PSA) BioAssay™ ELISA Kit (Guinea Pig), 202366-96Tests

Prostate Specific Antigen (PSA) BioAssay™ ELISA Kit (Guinea Pig), 202366-96Tests - Packaging/handling information product is carefully packaged in a vial inside a temperature/moisture resistant pouch most antigens are packaged in dry ice and the recommended storage is -65c repeated freeze thaw can cause a drop in antigenic activity refer to certificate of analysis and safety data sheet for additional information. Product information recombinant antigen applicable in elisa, western blot diagnostic assays. Return information no returns are accepted for open vials/bottles, or due to lack of product functionality meridian makes no claims of performance on any product user must determine optimal conditions that are suited for their application. Product specifications propagated in saccharomyces cerevisiae, protein concentration 10, 30mg/ml (pierce bca assay), buffer 50mm sodium phosphate, 160mm kci and 5mm dtt, ph 70 +/- 01 contains no perservatives refer to certificate of analysis for additional information. Shipping information product ships in dry ice immediately refrigerate or freeze on arrival see certificate of analysis to determine appropriate storage conditions.

 

Candida albicans ELISA Antigen Antigen

Candida albicans ELISA Antigen (Antigen)

Candida albicans ELISA Antigen (Antigen) - Free-8gb-usbdrive for this item item is for research use not for diagnostic/therapeutic procedure. Conc protein concentration 198mg/ml determined by bradford assay using bsa as standard. Specificity candida albicansagent candida albicans (wild type) culture system solid medium. Preservative none. Storage -20 to -80 degree c avoid repeated freezing and thawing. Tested elisa. Protein concentration 1mg/ml by bradford (bio-rad) assay using bsa as standard.

 

BRCAA1 AT Rich Interactive Domain 4B RBP1-like isoform 1 RBP1-like Protein Breast Carcinoma-associated Antigen BCAA Breast Cancer-associated Antigen BRCAA1 Retinoblastoma-binding Protein 1-like 1 SIN3A-associated Protein 180 B0085-04B-100ug

BRCAA1 (AT Rich Interactive Domain 4B (RBP1-like) isoform 1, RBP1-like Protein, Breast Carcinoma-associated Antigen BCAA, Breast Cancer-associated Antigen BRCAA1, Retinoblastoma-binding Protein 1-like 1, SIN3A-associated Protein 180), B0085-04B-100ug

BRCAA1 (AT Rich Interactive Domain 4B (RBP1-like) isoform 1, RBP1-like Protein, Breast Carcinoma-associated Antigen BCAA, Breast Cancer-associated Antigen BRCAA1, Retinoblastoma-binding Protein 1-like 1, SIN3A-associated Protein 180), B0085-04B-100ug - Purified by immunoaffinity chromatography. Pab. Supplied as a lyophilized powder each vial contains 5mg bsa, 09mg nacl, 02mg na2hpo4, 005mg thimerosal, 005mg nan3 reconstitution add 02ml of distilled water will yield a concentration of 500ug/ml. Recognizes human, mouse and rat adam17 no crossreactivity with other proteins.

 

CD49d Antigen CD49d CD49d Antigen CDw49d Alpha 4 Subunit of VLA-4 Receptor Integrin alpha IV Integrin alpha 4 IA4 ITGA4 LPAM23 MGC90518 Very Late Activation Protein 4 Receptor Alpha 4 Subunit VLA4 VLA-4 C2404-46K1-100ug

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4), C2404-46K1-100ug

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4), C2404-46K1-100ug - Further dilutions can be made in assay buffer. For long-term storage and to avoid repeated freezing and thawing, aliquot and store at -20°c. Other applications not tested. Storage and stability may be stored at 4°c for short-term only. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Recommended dilution flow cytometry 1ug/10e5 cells optimal dilutions to be determined by the researcher. Applications suitable for use in flow cytometry, immunohistochemistry (frozen), and immunoprecipitation. Aliquots are stable for at least 12 months at -20°c.

 

Nrf2 Recombinant Protein Antigen 01 ml

Nrf2 Recombinant Protein Antigen, 0.1 ml

Nrf2 Recombinant Protein Antigen, 0.1 ml - Sample type tissue homogenates, cell lysates and other biological fluids. Size 96t. Organism species homo sapiens (human). Type sandwich. Assay length 45hours.

 

AKAP3 A-kinase Anchor Protein 3 AKAP-3 A-kinase Anchor Protein 110kD AKAP 110 Protein Kinase A-anchoring Protein 3 AKAP110 CancerTestis Antigen 82 CT82 Fibrous Sheath Protein of 95kD FSP95 Fibrousheathin I Fibrousheathin-1 Protein Kinase A-a

AKAP3 (A-kinase Anchor Protein 3, AKAP-3, A-kinase Anchor Protein 110kD, AKAP 110, Protein Kinase A-anchoring Protein 3, AKAP110, Cancer/Testis Antigen 82, CT82, Fibrous Sheath Protein of 95kD, FSP95, Fibrousheathin I, Fibrousheathin-1, Protein Kinase A-a

AKAP3 (A-kinase Anchor Protein 3, AKAP-3, A-kinase Anchor Protein 110kD, AKAP 110, Protein Kinase A-anchoring Protein 3, AKAP110, Cancer/Testis Antigen 82, CT82, Fibrous Sheath Protein of 95kD, FSP95, Fibrousheathin I, Fibrousheathin-1, Protein Kinase A-a - Dilute only prior to immediate use. Note applications are based on unconjugated antibody. Stable for 12 months after receipt. Further dilutions can be made in assay buffer. Other applications not tested. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Applications suitable for use in elisa and western blot. Storage and stability may be stored at 4°c before opening. May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction in sperm. Freezing alkaline phosphatase conjugates will result in a substantial loss of activity. A-kinase anchor proteins (akaps) direct the activity of protein kinase a (pka) by tethering the enzyme near its physiologic substrates. Recommended dilution elisa 132,000 western blot 1-3ug/ml, observed in human testis lysates on ~90kd bands optimal dilutions to be determined by the researcher. Do not freeze stable at 4°c as an undiluted liquid.

 

BPHL Valacyclovir Hydrolase VACVase Valacyclovirase Biphenyl Hydrolase-like Protein Biphenyl Hydrolase-related Protein Bph-rp Breast Epithelial Mucin-associated Antigen MCNAA 123985-50ug

BPHL (Valacyclovir Hydrolase, VACVase, Valacyclovirase, Biphenyl Hydrolase-like Protein, Biphenyl Hydrolase-related Protein, Bph-rp, Breast Epithelial Mucin-associated Antigen, MCNAA), 123985-50ug

BPHL (Valacyclovir Hydrolase, VACVase, Valacyclovirase, Biphenyl Hydrolase-like Protein, Biphenyl Hydrolase-related Protein, Bph-rp, Breast Epithelial Mucin-associated Antigen, MCNAA), 123985-50ug - Store at -20°c. Applications suitable for use in western blot. Activates valacyclovir to acyclovir. Aliquots are stable for at least 12 months. Other applications not tested. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol. Aliquot to avoid repeated freezing and thawing. Aa sequence mprnllysllsshlsphfstsvtsakvavngvqlhyqqtgegdhavlllpgmlgsgetdfgpqlknlnkklftvvawdprgyghsrppdrdfpadfferdakdavdlmkalkfkkvsllgwsdggitaliaaakypsyihkmviwganayvtdedsmiyegirdvskwsertrkplealygydyfartcekwvdgirqfkhlpdgnicrhllprvqcpalivhgekdplvprfhadfihkhvkgsrlhlmpegkhnlhlrfadefnklaedflq storage and stability may be stored at 4°c for short-term only. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. May play a role in detoxification processes. Recommended dilution optimal dilutions to be determined by the researcher. Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir.

 

Meridian Life Science - Herpes Simplex Virus Type 2 HSV-2 gG2 Recombinant Antigen

Meridian Life Science – Herpes Simplex Virus Type 2 (HSV-2) gG2, Recombinant Antigen

Meridian Life Science – Herpes Simplex Virus Type 2 (HSV-2) gG2, Recombinant Antigen - Product specifications propagated in saccharomyces cerevisiae, protein concentration 10, 30mg/ml (pierce bca assay), buffer 50mm sodium phosphate, 160mm kci and 5mm dtt, ph 70 +/- 01 contains no perservatives refer to certificate of analysis for additional information. Product information recombinant antigen applicable in elisa, western blot diagnostic assays. Shipping information product ships in dry ice immediately refrigerate or freeze on arrival see certificate of analysis to determine appropriate storage conditions. Return information no returns are accepted for open vials/bottles, or due to lack of product functionality meridian makes no claims of performance on any product user must determine optimal conditions that are suited for their application. Packaging/handling information product is carefully packaged in a vial inside a temperature/moisture resistant pouch most antigens are packaged in dry ice and the recommended storage is -65c repeated freeze thaw can cause a drop in antigenic activity refer to certificate of analysis and safety data sheet for additional information.

 

Colon Cancer Specific Antigen-4 CCSA-4 BioAssay™ ELISA Kit Canine 188978-96Tests

Colon Cancer Specific Antigen-4 (CCSA-4) BioAssay™ ELISA Kit (Canine), 188978-96Tests

Colon Cancer Specific Antigen-4 (CCSA-4) BioAssay™ ELISA Kit (Canine), 188978-96Tests - Shipping information product ships in dry ice immediately refrigerate or freeze on arrival see certificate of analysis to determine appropriate storage conditions. Return information no returns are accepted for open vials/bottles, or due to lack of product functionality meridian makes no claims of performance on any product user must determine optimal conditions that are suited for their application. Product information recombinant antigen applicable in elisa, western blot diagnostic assays. Product specifications propagated in saccharomyces cerevisiae, protein concentration 10, 30mg/ml (pierce bca assay), buffer 50mm sodium phosphate, 160mm kci and 5mm dtt, ph 70 +/- 01 contains no perservatives refer to certificate of analysis for additional information. Packaging/handling information product is carefully packaged in a vial inside a temperature/moisture resistant pouch most antigens are packaged in dry ice and the recommended storage is -65c repeated freeze thaw can cause a drop in antigenic activity refer to certificate of analysis and safety data sheet for additional information.

 

CD152 CD152 Antigen Celiac Disease 3 CELIAC3 Cytotoxic T cell associated 4 Cytotoxic T-lymphocyte-associated Antigen 4 CTLA 4 CTLA4 CTLA-4 Cytotoxic T-lymphocyte-associated Protein 4 Cytotoxic T-lymphocyte-associated Serine Esterase 4 Cytotoxic

CD152 (CD152 Antigen, Celiac Disease 3, CELIAC3, Cytotoxic T cell associated 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA 4, CTLA4, CTLA-4, Cytotoxic T-lymphocyte-associated Protein 4, Cytotoxic T-lymphocyte-associated Serine Esterase 4, Cytotoxic

CD152 (CD152 Antigen, Celiac Disease 3, CELIAC3, Cytotoxic T cell associated 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA 4, CTLA4, CTLA-4, Cytotoxic T-lymphocyte-associated Protein 4, Cytotoxic T-lymphocyte-associated Serine Esterase 4, Cytotoxic - Fitc conjugates are sensitive to light. Studies suggest that cd152 is also expressed by regulatory t-lymphocytes. For long-term storage and to avoid repeated freezing and thawing, aliquot and store at -20°c. Further dilutions can be made in assay buffer. Aliquots are stable for at least 12 months at -20°c. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Other applications not tested. Cd152, also known as cytotoxic-t-lymphocyte antigen-4 (ctla-4), is similar in structure to cd28 and also binds ligands cd80 and cd86. Applications suitable for use in flow cytometry. Storage and stability may be stored at 4°c for short-term only. Cd152 is expressed by activated t-lymphocytes. Recommended dilution flow cytometry neat 10ul labels 10e6 cells in 100ul optimal dilutions to be determined by the researcher.

 

SOX13 SRY Sex Determining Region Y-box 13 Transcription Factor SOX-13 Islet Cell Antigen 12 ICA12 Type 1 Diabetes Autoantigen ICA12 PE 133716-PE-100ul

SOX13 (SRY (Sex Determining Region Y)-box 13 Transcription Factor SOX-13, Islet Cell Antigen 12, ICA12, Type 1 Diabetes Autoantigen ICA12) (PE), 133716-PE-100ul

SOX13 (SRY (Sex Determining Region Y)-box 13 Transcription Factor SOX-13, Islet Cell Antigen 12, ICA12, Type 1 Diabetes Autoantigen ICA12) (PE), 133716-PE-100ul - Aa sequence kseekkepcheapqgsataaepqpgdparasqdsadpqapaqgnfrgswdcsspegngspepkrpgvseaasgsqekldfnrnlkevvpaiekllssdwkerflgrnsmeakdv. Applications suitable for use in elisa and western blot. Recommended dilution optimal dilutions to be determined by the researcher. Other applications not tested.

 

Antigen KI-67 Ki-67 Human - ELISA - 96 wells

Antigen KI-67 (Ki-67), Human – ELISA – 96 wells

Antigen KI-67 (Ki-67), Human – ELISA – 96 wells - Detection kit / elisa, for serum, plasma, tissue homogenates. Others. Uniprot q02788. Range 0312 ng/ml-20 ng/ml. Sensitivity 0078 ng/ml.

 

MRP8 Protein S100-A8 Calgranulin-A Calprotectin L1L Subunit Cystic fibrosis Antigen CFAG Leukocyte L1 Complex Light Chain Migration Inhibitory Factor-Related Protein 8 MRP-8 S100 Calcium-Binding Protein A8 Urinary stone Protein band A Protein S

MRP8 (Protein S100-A8, Calgranulin-A, Calprotectin L1L Subunit, Cystic fibrosis Antigen, CFAG, Leukocyte L1 Complex Light Chain, Migration Inhibitory Factor-Related Protein 8, MRP-8, S100 Calcium-Binding Protein A8, Urinary stone Protein band A, Protein S

MRP8 (Protein S100-A8, Calgranulin-A, Calprotectin L1L Subunit, Cystic fibrosis Antigen, CFAG, Leukocyte L1 Complex Light Chain, Migration Inhibitory Factor-Related Protein 8, MRP-8, S100 Calcium-Binding Protein A8, Urinary stone Protein band A, Protein S - Other applications not tested. In addition, s-100 alpha and beta are present in a variety of other tissues and calbindin is present in intestine and kidney. Storage and stability may be stored at 4°c for short-term only. Applications suitable for use in western blot, immunohistochemistry. Calbindin, s-100 proteins and parvalbumin proteins are each expressed in neural tissues. Aliquots are stable for 12 months after receipt. Store at -20°c. Parvalbumin alpha is also found in fast-contracting/ relaxing skeletal muscle fibers and parvalbumin beta is found in many tumor tissues as well as in the organ of corti. Aliquot to avoid repeated freezing and thawing. The family of ef-hand type ca2+-binding proteins includes calbindin (previously designated vitamin d-dependent ca2+-binding protein), s-100 alpha and beta, cal-granulins a (also designated mrp8), b (also designated mrp14) and c (s-100 like proteins) and the parvalbumin family members, including parvalbumin alpha and parvalbumin beta (also designated oncomodulin). For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Recommended dilution western blot 1500-12000 immunohistochemistry 150-1200 optimal dilutions to be determined by the researcher.

 

CARS2 Recombinant Protein Antigen 01 ml

CARS2 Recombinant Protein Antigen, 0.1 ml

CARS2 Recombinant Protein Antigen, 0.1 ml - Purified by immunoaffinity chromatography. Recognizes human akap3 species sequence homology bovine, canine, mouse, porcine and rat. Supplied as a liquid in tris saline, 002% sodium azide, ph 73 conjugated to fluorescein isothiocyanate (fitc). Pab.

 

EXOSC5 Exosome Complex Component RRP46 Chronic Myelogenous Leukemia Tumor Antigen 28 Exosome Component 5 Ribosomal RNA-processing Protein 46 p12B CML28 RRP46 MGC111224 MGC12901 HRP 126515-HRP-100ul

EXOSC5 (Exosome Complex Component RRP46, Chronic Myelogenous Leukemia Tumor Antigen 28, Exosome Component 5, Ribosomal RNA-processing Protein 46, p12B, CML28, RRP46, MGC111224, MGC12901) (HRP), 126515-HRP-100ul

EXOSC5 (Exosome Complex Component RRP46, Chronic Myelogenous Leukemia Tumor Antigen 28, Exosome Component 5, Ribosomal RNA-processing Protein 46, p12B, CML28, RRP46, MGC111224, MGC12901) (HRP), 126515-HRP-100ul - The rna exosome may be involved in ig class switch recombination (csr) and/or ig variable region somatic hypermutation (shm) by targeting aicda deamination activity to transcribed dsdna substrates. Recommended dilution optimal dilutions to be determined by the researcher. The catalytic inactive rna exosome core complex of 9 subunits (exo-9) is proposed to play a pivotal role in the binding and presentation of rna for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. In the nucleus, the rna exosome complex is involved in proper maturation of stable rna species such as rrna, snrna and snorna, in the elimination of rna processing by-products and non-coding ‘pervasive’ transcripts, such as antisense rna species and promoter-upstream transcripts (prompts), and of mrnas with processing defects, thereby limiting or excluding their export to the cytoplasm. Non-catalytic component of the rna exosome complex which has 3′->5′ exoribonuclease activity and participates in a multitude of cellular rna processing and degradation events. It seems to be involved in degradation of histone mrna. Applications suitable for use in elisa and western blot. Aa sequence meeethtdakiraengtgssprgpgcslrhfaceqnllsrpdgsasflqgdtsvlagvygpaevkvskeifnkatlevilrpkiglpgvaeksrerlirn. Other applications not tested. In the cytoplasm, the rna exosome complex is involved in general mrna turnover and specifically degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′ untranslated regions, and in rna surveillance pathways, preventing translation of aberrant mrnas.

 

ADAM17 Snake venom-like protease TNF-alpha convertase TNF-alpha-converting enzyme CD_antigen CD156b 144125-100ug

ADAM17 (Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme, CD_antigen CD156b), 144125-100ug

ADAM17 (Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme, CD_antigen CD156b), 144125-100ug - Supplied as a lyophilized powder each vial contains 5mg bsa, 09mg nacl, 02mg na2hpo4, 005mg thimerosal, 005mg nan3 reconstitution add 02ml of distilled water will yield a concentration of 500ug/ml. Pab. Recognizes human, mouse and rat adam17 no crossreactivity with other proteins. Purified by immunoaffinity chromatography.

 

Colon Cancer Antigen CCA BioAssay™ ELISA Kit Human 188950-96Tests

Colon Cancer Antigen (CCA) BioAssay™ ELISA Kit (Human), 188950-96Tests

Colon Cancer Antigen (CCA) BioAssay™ ELISA Kit (Human), 188950-96Tests - S pneumoniae test latex one dropper bottle (yellow cap). Strep b test latex one dropper bottle (pink cap). H influenzae b test latex one dropper bottle (pale blue cap). N meningitidis acy w135 test latex one dropper bottle (gray cap).

 

Meridian Life Science Anti Sm Antigen

Meridian Life Science Anti Sm Antigen

Meridian Life Science Anti Sm Antigen - Type sandwich. Sample type tissue homogenates, cell lysates and other biological fluids. Assay length 45hours. Size 96t. Organism species homo sapiens (human).

 

CA IX Carbonic Anhydrase 9 Carbonate dehydratase IX Carbonic Anhydrase IX CA-IX CAIX Membrane Antigen MN P5458N Renal Cell Carcinoma-Associated Antigen G250 RCC-Associated Antigen G250 pMW1 CA9 G250 MN

CA IX (Carbonic Anhydrase 9, Carbonate dehydratase IX, Carbonic Anhydrase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-Associated Antigen G250, RCC-Associated Antigen G250 pMW1, CA9, G250, MN)

CA IX (Carbonic Anhydrase 9, Carbonate dehydratase IX, Carbonic Anhydrase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-Associated Antigen G250, RCC-Associated Antigen G250 pMW1, CA9, G250, MN) - Other applications not tested. Store at -20°c. Recommended dilution western blot 1500-11000 optimal dilutions to be determined by the researcher. Aliquots are stable for 12 months after receipt. Applications suitable for use in western blot. Storage and stability may be stored at 4°c for short-term only. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Cas are involved in a variety of biological processes, including respiration, calcification,acid-base balance, bone resorption and the formation of aqueous humor,cerebrospinal fluid, saliva and gastric juice. 3, 15q22 and 1q21, respectively, encode transmembrane proteins that have unique patterns of tissue-specific expression. They show extensive diversity in distribution and in their subcellular localization. Ca ix is specifically expressed in clear-cell renal carcinomas, whereas ca xii is highly expressed in normal tissues, such as kidney, colon and pancreas. The human ca9,ca12 and ca14 genes, which map to chromosomes 9p13. Aliquot to avoid repeated freezing and thawing.

 

Prostate Specific Antigen PSA BioAssay ELISA Kit Human 202367-96Tests

Prostate Specific Antigen (PSA) BioAssay ELISA Kit (Human), 202367-96Tests

Prostate Specific Antigen (PSA) BioAssay ELISA Kit (Human), 202367-96Tests - S pneumoniae test latex one dropper bottle (yellow cap). Strep b test latex one dropper bottle (pink cap). H influenzae b test latex one dropper bottle (pale blue cap). N meningitidis acy w135 test latex one dropper bottle (gray cap).