Top 23 Lims


LIM Kinase 1 Overexpression Lysate Denatured 01 ml #ad

LIM Kinase 1 Overexpression Lysate (Denatured), 0.1 ml

LIM Kinase 1 Overexpression Lysate (Denatured), 0.1 ml #ad - 1 ml. Size 0.


LIM kinase 2 Antibody 01 mg #ad

LIM kinase 2 Antibody, 0.1 mg

LIM kinase 2 Antibody, 0.1 mg #ad - A. Mgsylsvpayftsrdlfrcsecqdsltnwyyekdgklycpkdywgkfgefchgcsllmtgpfmvagefkyhpecfacmsckviiedgdayalvqhatlycgkchnevvlapmferlstesvqeqlpysvtlismpattegrrgfsvsvesacsnyattvqvkevnrmhispnnrnaihpgdrileingtpvrtlrveevedaisqtsqtlqlliehdpvsqrldqlrlearlaphmqnaghphalstldtkenlegtlrrrslrrsnsiskspgpsspkepllfsrdisrseslrcsssysqqifrpcdlihgevlgkgffgqaikvthkatgkvmvmkelircdeetqktfltevkvmrsldhpnvlkfigvlykdkklnllteyieggtlkdflrsmdpfpwqqkvrfakgiasgmaylhsmciihrdlnshnclikldktvvvadfglsrliveerkrapmekattkkrtlrkndrkkrytvvgnpywmapemlngksydetvdifsfgivlceiigqvyadpdclprtldfglnvklfwekfvptdcppaffplaaiccrlepesrappgaagegpgcaddegpvrrqgkvtikydpkelrkhlnleewileqltrlydcqeeeiseleidvdelldmesddawasrvkellvdcykpteafisglldkiramqklstpqkkapplications western blot. ) Full-length human protein. This antibody reacts with human, mouse. 1, 1 a. 1 mgspecies reactivity human, mousehost rabbit polyclonalisotype iggconjugate unconjugatedimmunogen limk2 (np_001026971. A. Size 0., 686 a. The lim kinase 2 antibody has been validated for the following applications western blot. Description the lim kinase 2 antibody from novus is a rabbit polyclonal antibody to lim kinase 2.


LIM Kinase 1 Recombinant Protein Antigen 01 ml #ad

LIM Kinase 1 Recombinant Protein Antigen, 0.1 ml

LIM Kinase 1 Recombinant Protein Antigen, 0.1 ml #ad - 1 mlspecies humanapplications antibody competition. Size 0.


Lim - GeneMate 34 x 500 Specialty Labeling Tape #ad

Lim – GeneMate 3/4″ x 500″ Specialty Labeling Tape

Lim – GeneMate 3/4″ x 500″ Specialty Labeling Tape #ad - Tape adheres to any dry surface and removes cleanly and easily. It can be written on with pen, pencil or permanent marker. The tape can withstand temperatures from -23°c to 121°c. Specialty labeling tape is oil and acid resistant, waterproof and durable. 500″ rolls have a 1″ core. Colors available are yellow, red, green, orange, blue, pink and white.


LIMhomeobox protein Lhx3 LHX3 Goat ELISA Kit #ad

LIM/homeobox protein Lhx3 (LHX3), Goat, ELISA Kit

LIM/homeobox protein Lhx3 (LHX3), Goat, ELISA Kit #ad - Product codee06l0331productlim/homeobox protein lhx3 (lhx3), goat, elisa kitspeciesgoatintended usefor research use only.


Lim - GeneMate 34 x 60 yards Specialty Labeling Tape #ad

Lim – GeneMate 3/4″ x 60 yards Specialty Labeling Tape

Lim – GeneMate 3/4″ x 60 yards Specialty Labeling Tape #ad - 60 yard rolls have a 3″ core. The tape adheres to any dry surface and removes cleanly and easily. It can be written on with pen, pencil or permanent marker. Specialty labeling tape is oil and acid resistant, waterproof and durable.


Durable Safety DSC2PMV4XLLIM Class 2 Premium Mesh Vest 4XL Lime #ad

Durable Safety DSC2PMV.4XL.LIM Class 2 Premium Mesh Vest, 4XL, Lime

Durable Safety DSC2PMV.4XL.LIM Class 2 Premium Mesh Vest, 4XL, Lime #ad - Class 2 premium mesh vest with contrast trim. Available in lime or orange. Sold in each.


LIM Kinase 1 Antibody 2E9 01 mg #ad

LIM Kinase 1 Antibody (2E9.), 0.1 mg

LIM Kinase 1 Antibody (2E9.), 0.1 mg #ad - A. Description the lim kinase 1 antibody (2e9. A. ) Partial recombinant protein with gst tag. Adpdylprtmdfglnvrgfldrycppncppsffpitvrccdldpekrpsfvklehwletlrmhlaghlplgpqleqldrgfwetyrrgesglpahpevpdapplications western blot, elisa, immunohistochemistry-paraffin. ) From novus is a mouse monoclonal antibody to lim kinase 1. ) Has been validated for the following applications western blot, elisa, immunohistochemistry-paraffin. Isotype igg2a kappaconjugate unconjugatedimmunogen limk1 (np_002305 548 a. Size 0., 647 a. The lim kinase 1 antibody (2e9. Mw of the gst tag alone is 26 kda. 1 mgspecies reactivity humanhost mouse monoclonalclone 2e9. This antibody reacts with human.


LIM domain only 3 Antibody 4A8 01 mg #ad

LIM domain only 3 Antibody (4A8), 0.1 mg

LIM domain only 3 Antibody (4A8), 0.1 mg #ad - Size 0. The lim domain only 3 antibody (4a8) has been validated for the following applications western blot, elisa, immunocytochemistry / immunofluorescence. Mrakdnvyhldcfacqlcnqrfcvgdkfflknnmilcqtdyeeglmkegyapqvrapplications western blot, elisa, immunocytochemistry/immunofluorescence. Description the lim domain only 3 antibody (4a8) from novus is a mouse monoclonal antibody to lim domain only 3. 1 mgspecies reactivity humanhost mouse monoclonalclone 4a8isotype igg2b kappaconjugate unconjugatedimmunogen lmo3 (np_061110, 91 a. This antibody reacts with human. A. ~ 146 a. A) partial recombinant protein with gst tag.


LIM Kinase 1 Antibody 1B2 005 mg #ad

LIM Kinase 1 Antibody (1B2), 0.05 mg

LIM Kinase 1 Antibody (1B2), 0.05 mg #ad - Size 0. Description the lim kinase 1 antibody (1b2) from novus is a mouse monoclonal antibody to lim kinase 1. A. Adpdylprtmdfglnvrgfldrycppncppsffpitvrccdldpekrpsfvklehwletlrmhlaghlplgpqleqldrgfwetyrrgesglpahpevpdapplications western blot, elisa, immunohistochemistry-paraffin. ) Partial recombinant protein with gst tag., 647 a. A. 05 mgspecies reactivity humanhost mouse monoclonalclone 1b2isotype igg1 kappaconjugate unconjugatedimmunogen limk1 (np_002305 548 a. Mw of the gst tag alone is 26 kda. The lim kinase 1 antibody (1b2) has been validated for the following applications western blot, elisa, immunohistochemistry-paraffin. This antibody reacts with human.


LIM Kinase 1 Antibody 01 ml #ad

LIM Kinase 1 Antibody, 0.1 ml

LIM Kinase 1 Antibody, 0.1 ml #ad - Description the lim kinase 1 antibody from novus biologicals is a rabbit polyclonal antibody to lim kinase 1. 1 mlspecies reactivity humanhost rabbit polyclonalisotype iggconjugate unconjugatedimmunogen this antibody was developed against recombinant protein corresponding to amino acidsehsklycghcyyqtvvtpvieqilpdspgshlphtvtlvsipasshgkrglsvsidpphgppgcgtehshtvrvqgvdpgcmspdvknsihvapplications immunohistochemistry, immunocytochemistry/immunofluorescence, immunohistochemistry-paraffincitations 2. This antibody reacts with human. Size 0. The lim kinase 1 antibody has been validated for the following applications immunohistochemistry, immunocytochemistry / immunofluorescence, immunohistochemistry-paraffin.


LIM kinase 2 Antibody 01 mg #ad

LIM kinase 2 Antibody, 0.1 mg

LIM kinase 2 Antibody, 0.1 mg #ad - 1 mgspecies reactivity humanhost rabbit polyclonalisotype iggconjugate unconjugatedimmunogen this antibody is specific for the middle region of the target protein. Description the lim kinase 2 antibody from novus biologicals is a rabbit polyclonal antibody to lim kinase 2. The lim kinase 2 antibody has been validated for the following applications western blot, elisa, immunohistochemistry, immunohistochemistry-paraffin. Applications western blot, elisa, immunohistochemistry, immunohistochemistry-paraffincitations 2. This antibody reacts with human. Size 0.


LIM Kinase 1 Antibody 1A8 100 ug #ad

LIM Kinase 1 Antibody (1A8), 100 ug

LIM Kinase 1 Antibody (1A8), 100 ug #ad - A. Size 100 ugspecies reactivity human, mouse, rathost mouse monoclonalclone 1a8isotype igg2a kappaconjugate unconjugatedimmunogen limk1 (np_002305 548 a. Adpdylprtmdfglnvrgfldrycppncppsffpitvrccdldpekrpsfvklehwletlrmhlaghlplgpqleqldrgfwetyrrgesglpahpevpdapplications western blot, elisa, immunohistochemistry-paraffin. A. This antibody reacts with human, mouse, rat. Mw of the gst tag alone is 26 kda. The lim kinase 1 antibody (1a8) has been validated for the following applications western blot, elisa, immunohistochemistry-paraffin., 647 a. Description the lim kinase 1 antibody (1a8) from novus is a mouse monoclonal antibody to lim kinase 1. ) Partial recombinant protein with gst tag.


Lim - GeneMate 12 x 500 Specialty Labeling Tape #ad

Lim – GeneMate 1/2″ x 500″ Specialty Labeling Tape

Lim – GeneMate 1/2″ x 500″ Specialty Labeling Tape #ad - Tapes can be written on with pen, pencil, or permanent marker. Rainbow option includes three each of blue, red, orange, green, pink, four yellow, and five white. Oil resistant, durable, waterproof, and acid resistant. The 500″ rolls have a 1″ core. Adheres to any dry surface and removes cleanly and easily.


LIM Kinase 1 Antibody 01 mg #ad

LIM Kinase 1 Antibody, 0.1 mg

LIM Kinase 1 Antibody, 0.1 mg #ad - A. 1, 1 a. Description the lim kinase 1 antibody from novus is a rabbit polyclonal antibody to lim kinase 1. Mrltllcctwreermgeegselpvcascgqriydgqylqalnadwhadcfrccdcsaslshqyyekdgqlfckkdywarygeschgcseqitkglvmvagelkyhpecficltcgtfigdgdtytlvehsklycghcyyqtvvtpvieqilpdspgshlphtvtlvsipasshgkrglsvsidpphgppgcgtehshtvrvqgvdpgcmspdvknsihvgdrileingtpirnvpldeidlliqetsrllqltlehdphdtlghglgpetsplsspaytpsgeagssarqkpvlrscsidrspgagslgspasqrkdlgrseslrvvcrphrifrpsdlihgevlgkgcfgqaikvthretgevmvmkelirfdeetqrtflkevkvmrclehpnvlkfigvlykdkrlnfiteyikggtlrgiiksmdsqypwsqrvsfakdiasgmaylhsmniihrdlnshnclvrenknvvvadfglarlmvdektqpeglrslkkpdrkkrytvvgnpywmapemingrsydekvdvfsfgivlceiigrvnadpdylprtmdfglnvrgfldrycppncppsffpitvrccdldpekrpsfvklehwletlrmhlaghlplgpqleqldrgfwetyrrgesglpahpevpdapplications western blot, immunocytochemistry/immunofluorescence. Size 0., 647 a. The lim kinase 1 antibody has been validated for the following applications western blot, immunocytochemistry / immunofluorescence. This antibody reacts with human, mouse. ) Full-length human protein. A. 1 mgspecies reactivity human, mousehost rabbit polyclonalisotype iggconjugate unconjugatedimmunogen limk1 (aai52983.


LIM Kinase 1 RNAi 20 nmol #ad

LIM Kinase 1 RNAi, 20 nmol

LIM Kinase 1 RNAi, 20 nmol #ad - Size 20 nmol.


LIM kinase 2 RNAi 20 nmol #ad

LIM kinase 2 RNAi, 20 nmol

LIM kinase 2 RNAi, 20 nmol #ad - Size 20 nmol.


LIM domain only 3 Antibody 2H2 01 mg #ad

LIM domain only 3 Antibody (2H2), 0.1 mg

LIM domain only 3 Antibody (2H2), 0.1 mg #ad - Description the lim domain only 3 antibody (2h2) from novus is a mouse monoclonal antibody to lim domain only 3. 1 mgspecies reactivity humanhost mouse monoclonalclone 2h2isotype igg2a kappaconjugate unconjugatedimmunogen lmo3 (np_061110, 91 a. This antibody reacts with human. Mrakdnvyhldcfacqlcnqrfcvgdkfflknnmilcqtdyeeglmkegyapqvrapplications western blot, elisa, immunocytochemistry/immunofluorescence. ~ 146 a. A. The lim domain only 3 antibody (2h2) has been validated for the following applications western blot, elisa, immunocytochemistry / immunofluorescence. Size 0. A) partial recombinant protein with gst tag.


LIM domain only 3 RNAi 20 nmol #ad

LIM domain only 3 RNAi, 20 nmol

LIM domain only 3 RNAi, 20 nmol #ad - Size 20 nmol.


LIM and cysteine-rich domains protein 1 LMCD1 Goat ELISA Kit #ad

LIM and cysteine-rich domains protein 1 (LMCD1), Goat, ELISA Kit

LIM and cysteine-rich domains protein 1 (LMCD1), Goat, ELISA Kit #ad - Product codee06l0332productlim and cysteine-rich domains protein 1 (lmcd1), goat, elisa kitspeciesgoatintended usefor research use only.


LIM kinase 2 Antibody 2H2-E11 01 mg #ad

LIM kinase 2 Antibody (2H2-E11), 0.1 mg

LIM kinase 2 Antibody (2H2-E11), 0.1 mg #ad - Mgsylsvpayftsrdlfrcsecqdsltnwyyekdgklycpkdywgkfgefchgcsllmtgpfmvagefkyhpecfacmsckviiedgdayalvqhatlycgkchnevvlapmferlstesvqeqlpysvtlismpattegrrgfsvsvesacsnyattvqvkevnrmhispnnrnaihpgdrileingtpvrtlrveevedaisqtsqtlqlliehdpvsqrldqlrlearlaphmqnaghphalstldtkenlegtlrrrslrrsnsiskspgpsspkepllfsrdisrseslrcsssysqqifrpcdlihgevlgkgffgqaikvthkatgkvmvmkelircdeetqktfltevkvmrsldhpnvlkfigvlykdkklnllteyieggtlkdflrsmdpfpwqqkvrfakgiasgmaylhsmciihrdlnshnclikldktvvvadfglsrliveerkrapmekattkkrtlrkndrkkrytvvgnpywmapemlngksydetvdifsfgivlceiigqvyadpdclprtldfglnvklfwekfvptdcppaffplaaiccrlepesrappgaagegpgcaddegpvrrqgkvtikydpkelrkhlnleewileqltrlydcqeeeiseleidvdelldmesddawasrvkellvdcykpteafisglldkiramqklstpqkkapplications western blot, elisa, immunocytochemistry/immunofluorescence. 1, 1 a. Size 0. Description the lim kinase 2 antibody (2h2-e11) from novus is a mouse monoclonal antibody to lim kinase 2. The lim kinase 2 antibody (2h2-e11) has been validated for the following applications western blot, elisa, immunocytochemistry / immunofluorescence. 1 mgspecies reactivity humanhost mouse monoclonalclone 2h2-e11isotype igg1 kappaconjugate unconjugatedimmunogen limk2 (aah13051., 686 a. A. Mw of the gst tag alone is 26 kda. A. ) Full-length recombinant protein with gst tag. This antibody reacts with human.


LIM Kinase 1 RNAi 20 nmol #ad

LIM Kinase 1 RNAi, 20 nmol

LIM Kinase 1 RNAi, 20 nmol #ad - Size 20 nmol.


LIM homeobox transcription factor 1b Goat ELISA Kit #ad

LIM homeobox transcription factor 1b, Goat, ELISA Kit

LIM homeobox transcription factor 1b, Goat, ELISA Kit #ad - Product codee06l0306productlim homeobox transcription factor 1b, goat, elisa kitspeciesgoatintended usefor research use only.

We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to and affiliated sites.