Top 17 Rna Processings


EXOSC3 Exosome Complex Exonuclease RRP40 Ribosomal RNA-processing Protein 40 Exosome Component 3 p10 RRP40 CGI-102 MGC15120 MGC723 RP11-3J108 Rrp40p bA3J107 hRrp40p p10 HRP 126511-HRP-100ul

EXOSC3 (Exosome Complex Exonuclease RRP40, Ribosomal RNA-processing Protein 40, Exosome Component 3, p10, RRP40, CGI-102, MGC15120, MGC723, RP11-3J10.8, Rrp40p, bA3J10.7, hRrp40p, p10) (HRP), 126511-HRP-100ul

EXOSC3 (Exosome Complex Exonuclease RRP40, Ribosomal RNA-processing Protein 40, Exosome Component 3, p10, RRP40, CGI-102, MGC15120, MGC723, RP11-3J10.8, Rrp40p, bA3J10.7, hRrp40p, p10) (HRP), 126511-HRP-100ul - Other applications not tested. Recommended dilution immunohistochemistry (formalin fixed paraffin embedded) 3ug/ml optimal dilutions to be determined by the researcher. Aa sequence maepasvaaeslagsraraartvlgqvvlpgeelllpeqedaegpggaverplslnaracsrvrvvcgpglrrcgdrllvtkcgrlrhkepgsgsgggvywvdsqqkryvpvkgdhvigivtaksgdifkvdvggsepaslsylsfegatkrnrpnvqvgdliygqfvvankdmepemvcidscgrangmgvigqdgllfkvtlglirkllapdceiiqevgklypleivfgmngriwvkaktiqqtlilanileacehmtsdqrkqifsrlaes. Applications suitable for use in elisa, western blot and immunohistochemistry. Exosc3 is a component of the exosome 3′->5′ exoribonuclease complex, a complex that degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′ untranslated regions. 8s rrna. It is required for the 3’processing of the 7s pre-rna to the mature 5. It has a 3′-5′ exonuclease activity.


CF153 CT RRP36 Ribosomal RNA processing protein 36 homolog Azide free HRP 033805-HRP-200ul

CF153, CT (RRP36, Ribosomal RNA processing protein 36 homolog) (Azide free) (HRP), 033805-HRP-200ul

CF153, CT (RRP36, Ribosomal RNA processing protein 36 homolog) (Azide free) (HRP), 033805-HRP-200ul - Further dilutions can be made in assay buffer. Aliquots are stable at -20°c for 12 months after receipt. Dilute required amount only prior to immediate use. Note applications are based on unconjugated antibody. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Rrp36 functions at an early stage in the processing of 35s preribosomal rna into the mature 18s species (gerus et al. , 2010 [pubmed 20038530]). Applications suitable for use in western blot, immunohistochemistry elisa recommended dilution elisa 11,000 western blot 1100-500 immunohistochemistry 150-100 storage and stability store product at 4°c if to be used immediately within two weeks. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.


EXOSC2 Exosome Complex Component RRP4 Exosome Component 2 Ribosomal RNA-processing Protein 4 RRP4 p7 PE 126507-PE-100ul

EXOSC2 (Exosome Complex Component RRP4, Exosome Component 2, Ribosomal RNA-processing Protein 4, RRP4, p7) (PE), 126507-PE-100ul

EXOSC2 (Exosome Complex Component RRP4, Exosome Component 2, Ribosomal RNA-processing Protein 4, RRP4, p7) (PE), 126507-PE-100ul - In the nucleus, the rna exosome complex is involved in proper maturation of stable rna species such as rrna, snrna and snorna, in the elimination of rna processing by-products and non-coding ‘pervasive’ transcripts, such as antisense rna species and promoter-upstream transcripts (prompts), and of mrnas with processing defects, thereby limiting or excluding their export to the cytoplasm. Non-catalytic component of the rna exosome complex which has 3′->5′ exoribonuclease activity and participates in a multitude of cellular rna processing and degradation events. It seems to be involved in degradation of histone mrna. Aa sequence alktryigevgdivvgritevqqkrwkvetnsrldsvlllssmnlpggelrrrsaedelamrgflqegdlisaevqavfsdgavslhtrs. The catalytic inactive rna exosome core complex of 9 subunits (exo-9) is proposed to play a pivotal role in the binding and presentation of rna for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. Applications suitable for use in elisa. Exosc2 as peripheral part of the exo-9 complex stabilizes the hexameric ring of rnase ph-domain subunits through contacts with exosc4 and exosc7. In the cytoplasm, the rna exosome complex is involved in general mrna turnover and specifically degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′ untranslated regions, and in rna surveillance pathways, preventing translation of aberrant mrnas. Recommended dilution optimal dilutions to be determined by the researcher. The rna exosome may be involved in ig class switch recombination (csr) and/or ig variable region somatic hypermutation (shm) by targeting aicda deamination activity to transcribed dsdna substrates. Other applications not tested.


RRP1 ID RRP1 D21S2056E NNP1 NOP52 RRP1A Ribosomal RNA processing protein 1 homolog A Novel nuclear protein 1 Nucleolar protein Nop52 RRP1-like protein AP 041284-AP-200ul

RRP1, ID (RRP1, D21S2056E, NNP1, NOP52, RRP1A, Ribosomal RNA processing protein 1 homolog A, Novel nuclear protein 1, Nucleolar protein Nop52, RRP1-like protein) (AP), 041284-AP-200ul

RRP1, ID (RRP1, D21S2056E, NNP1, NOP52, RRP1A, Ribosomal RNA processing protein 1 homolog A, Novel nuclear protein 1, Nucleolar protein Nop52, RRP1-like protein) (AP), 041284-AP-200ul - Dilute required amount only prior to immediate use. The encoded protein is involved in the late stages of nucleologenesis at the end of mitosis, and may be required for the generation of 28s rrna. Do not freeze stable at 4°c for 12 months after receipt as an undiluted liquid. The protein encoded by this gene is the putative homolog of the yeast ribosomal rna processing protein rrp1. Note applications are based on unconjugated antibody. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Applications suitable for use in western blot, elisa recommended dilution elisa 11,000 western blot 1100-500 storage and stability store product at 4°c.


EXOSC4 RRP41 SKI6 Exosome Complex Component RRP41 Exosome Component 4 Ribosomal RNA-processing Protein 41 p12A FLJ20591 RRP41A Rrp41p SKI6 Ski6p HRrp41p PE 126512-PE-100ul

EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p) (PE), 126512-PE-100ul

EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p) (PE), 126512-PE-100ul - 8s rrna. Applications suitable for use in elisa and western blot. Recommended dilution optimal dilutions to be determined by the researcher. Aa sequence maglellsdqgyrvdgrragelrkiqarmgvfaqadgsayieqgntkalavvygpheirgsraralpdralvncqyssatfstgerkrrphgdrkscemg. Has a 3′-5′ exonuclease activity. Other applications not tested. Required for the 3′-processing of the 7s pre-rna to the mature 5. Component of the exosome 3′->5′ exoribonuclease complex, a complex that degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′-untranslated regions. Plays a role in replication-dependent histone mrna degradation.


EXOSC3 Exosome Complex Exonuclease RRP40 Ribosomal RNA-processing Protein 40 Exosome Component 3 p10 RRP40 CGI-102 MGC15120 MGC723 RP11-3J108 Rrp40p bA3J107 hRrp40p p10 FITC 126510-FITC-100ul

EXOSC3 (Exosome Complex Exonuclease RRP40, Ribosomal RNA-processing Protein 40, Exosome Component 3, p10, RRP40, CGI-102, MGC15120, MGC723, RP11-3J10.8, Rrp40p, bA3J10.7, hRrp40p, p10) (FITC), 126510-FITC-100ul

EXOSC3 (Exosome Complex Exonuclease RRP40, Ribosomal RNA-processing Protein 40, Exosome Component 3, p10, RRP40, CGI-102, MGC15120, MGC723, RP11-3J10.8, Rrp40p, bA3J10.7, hRrp40p, p10) (FITC), 126510-FITC-100ul - It has a 3′-5′ exonuclease activity. Other applications not tested. Recommended dilution optimal dilutions to be determined by the researcher. Aa sequence maepasvaaeslagsraraartvlgqvvlpgeelllpeqedaegpggaverplslnaracsrvrvvcgpglrrcgdrllvtkcgrlrhkepgsgsgggvywvdsqqkryvpvkgdhvigivtaksgdifkvdvggsepaslsylsfegatkrnrpnvqvgdliygqfvvankdmepemvcidscgrangmgvigqdgllfkvtlglirkllapdceiiqevgklypleivfgmngriwvkaktiqqtlilanileacehmtsdqrkqifsrlaes. Applications suitable for use in western blot. 8s rrna. Exosc3 is a component of the exosome 3′->5′ exoribonuclease complex, a complex that degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′ untranslated regions. It is required for the 3’processing of the 7s pre-rna to the mature 5.


EXOSC7 Exosome Complex Exonuclease RRP42 Ribosomal RNA-processing Protein 42 Exosome Component 7 p8 KIAA0116 RRP42 FLJ26543 hRrp42p PE 126516-PE-100ul

EXOSC7 (Exosome Complex Exonuclease RRP42, Ribosomal RNA-processing Protein 42, Exosome Component 7, p8, KIAA0116, RRP42, FLJ26543, hRrp42p) (PE), 126516-PE-100ul

EXOSC7 (Exosome Complex Exonuclease RRP42, Ribosomal RNA-processing Protein 42, Exosome Component 7, p8, KIAA0116, RRP42, FLJ26543, hRrp42p) (PE), 126516-PE-100ul - Other applications not tested. Applications suitable for use in elisa. Aa sequence lsvenvpcivtlckigyrhvvdatlqeeacslasllvsvtskgvvtcmrkvgkgsldpesifemmetgkrvgkvlhaslqsvlhkeeslgpkrqkvgflg. Recommended dilution optimal dilutions to be determined by the researcher. 8s rrna and has a 3′-5′ exonuclease activity. Exosc7 is a component of the exosome 3′->5′ exoribonuclease complex, a complex that degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′-untranslated regions. The protein is required for the 3′-processing of the 7s pre-rna to the mature 5.


EXOSC4 RRP41 SKI6 Exosome Complex Component RRP41 Exosome Component 4 Ribosomal RNA-processing Protein 41 p12A FLJ20591 RRP41A Rrp41p SKI6 Ski6p HRrp41p FITC 126512-FITC-100ul

EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p) (FITC), 126512-FITC-100ul

EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p) (FITC), 126512-FITC-100ul - Has a 3′-5′ exonuclease activity. Other applications not tested. 8s rrna. Recommended dilution optimal dilutions to be determined by the researcher. Required for the 3′-processing of the 7s pre-rna to the mature 5. Plays a role in replication-dependent histone mrna degradation. Component of the exosome 3′->5′ exoribonuclease complex, a complex that degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′-untranslated regions. Aa sequence maglellsdqgyrvdgrragelrkiqarmgvfaqadgsayieqgntkalavvygpheirgsraralpdralvncqyssatfstgerkrrphgdrkscemg. Applications suitable for use in elisa and western blot.


RRP12 Ribosomal RNA Processing 12 Homolog RRP12-like Protein KIAA0690 132855-50ug

RRP12 (Ribosomal RNA Processing 12 Homolog, RRP12-like Protein, KIAA0690), 132855-50ug

RRP12 (Ribosomal RNA Processing 12 Homolog, RRP12-like Protein, KIAA0690), 132855-50ug - Recommended dilution immunofluorescence 10ug/ml optimal dilutions to be determined by the researcher. Other applications not tested. Aliquot to avoid repeated freezing and thawing. Applications suitable for use in immunofluorescence and western blot. Aa sequence mgrsgklpsgvsaklkrwkkghssdsnpaicrhrqaarsrffsrpsgrsdltvdavklhnelqsgslrlgkseapetpmeeeaelvltekssgtflsglsdctnvtfskvqrfwesnsaahkeicavlaavtevirsqggketeteyfaalmttmeavespeslaavayllnlvlkrvpspvlikkfsdtskafmdimsaqassgstsvlrwvlsclatllrkqdleawgypvtlqvyhgllsftvhpkpkirkaaqhgvcsvlkgsefmfekapahhpaaistakfciqeieksggskeatttlhmltllkdllpcfpeglvkscsetllrvmtlshvlvtacamqafhslfharpglstlsaelnaqiitalydyvpsendlqpllawlkvmekahinlvrlqwdlglghlprffgtavtcllsphsqvltaatqslkeilkecvaphmadigsvtssasgpaqsvakmfraveegltykfhaawssvlqllcvffeacgrqahpvmrkclqslcdlrlsphfphtaaldqavgaavtsmgpevvlqavpleidgseetldfprswllpvirdhvqetrlgffttyflplantlkskamdlaqagstveskiydtlqwqmwtllpgfctrptdvaisfkglartlgmaiserpdlrvtvcqalrtlitkgcqaeadraevsrfaknflpilfnlygqpvaagdtpaprravletirtyltitdtqlvnsllekasekvldpassdftrlsvldlvvalapcadeaaisklystirpyleskahgvqkkayrvleevcaspqgpgalfvqshledlkktlldslrstsspakrprlkcllhivrklsaehkefitalipevilctkevsvgarknafallvemghaflrfgsnqeealqcylvliypglvgavtmvscsilalthllfefkglmgtstveqllenvclllasrtrdvvksalgfikvavtvmdvahlakhvqlvmeaigklsddmrrhfrmklrnlftkfirkfgfelvkrllpeeyhrvlvnirkaearakrhralsqaaveeeeeeeeeeepaqgkgdsieeiladsedeedneeeersrgkeqrklarqrsrawlkegggdeplnfldpkvaqrvlatqpgpgrgrkkdhsfkvsadgrliireeadgnkmeeeegakgedeemadpmedviirnkkhqklkhqkeaeeeeleippqyqaggsgihrpvakkampgaeykakkakgdvkkkgrpdpyayiplnrsklnrrkkmklqgqfkglvkaarrgsqvghknrrkdrrp storage and stability may be stored at 4°c for short-term only. Store at -20°c. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.


Ribosomal Rna Processing 1 Homolog S Cerevisiae Antibody

Ribosomal Rna Processing 1 Homolog (S. Cerevisiae) Antibody

Ribosomal Rna Processing 1 Homolog (S. Cerevisiae) Antibody - Rabbit polyclonal antibody against ribosomal rna processing 1 homolog s cerevisiae. Free 8 gb usb flash drive with your order this product is for research use only. Reactivity human. Rabbit polyclonal, size 50 l more sizes available, please contact us on [email protected] for details. Tested applications elisa, wb.


RRP1 ID RRP1 D21S2056E NNP1 NOP52 RRP1A Ribosomal RNA processing protein 1 homolog A Novel nuclear protein 1 Nucleolar protein Nop52 RRP1-like protein Azide free HRP 041284-HRP-200ul

RRP1, ID (RRP1, D21S2056E, NNP1, NOP52, RRP1A, Ribosomal RNA processing protein 1 homolog A, Novel nuclear protein 1, Nucleolar protein Nop52, RRP1-like protein) (Azide free) (HRP), 041284-HRP-200ul

RRP1, ID (RRP1, D21S2056E, NNP1, NOP52, RRP1A, Ribosomal RNA processing protein 1 homolog A, Novel nuclear protein 1, Nucleolar protein Nop52, RRP1-like protein) (Azide free) (HRP), 041284-HRP-200ul - Applications suitable for use in western blot, elisa recommended dilution elisa 11,000 western blot 1100-500 storage and stability store product at 4°c if to be used immediately within two weeks. Further dilutions can be made in assay buffer. The protein encoded by this gene is the putative homolog of the yeast ribosomal rna processing protein rrp1. The encoded protein is involved in the late stages of nucleologenesis at the end of mitosis, and may be required for the generation of 28s rrna. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Note applications are based on unconjugated antibody. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable at -20°c for 12 months after receipt. Dilute required amount only prior to immediate use. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates.


RRP1B NT RRP1B KIAA0179 Ribosomal RNA processing protein 1 homolog B RRP1-like protein B AP 041286-AP-200ul

RRP1B, NT (RRP1B, KIAA0179, Ribosomal RNA processing protein 1 homolog B, RRP1-like protein B) (AP), 041286-AP-200ul

RRP1B, NT (RRP1B, KIAA0179, Ribosomal RNA processing protein 1 homolog B, RRP1-like protein B) (AP), 041286-AP-200ul - Applications suitable for use in western blot, elisa recommended dilution elisa 11,000 western blot 1100-500 storage and stability store product at 4°c. Do not freeze stable at 4°c for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. It may be a novel susceptibility gene for breast cancer progression and metastasis. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Rrp1b belongs to the rrp1 family. Further dilutions can be made in assay buffer. Note applications are based on unconjugated antibody.


RRP7A CT RRP7A Ribosomal RNA-processing protein 7 homolog A Gastric cancer antigen Zg14 Azide free HRP 041287-HRP-200ul

RRP7A, CT (RRP7A, Ribosomal RNA-processing protein 7 homolog A, Gastric cancer antigen Zg14) (Azide free) (HRP), 041287-HRP-200ul

RRP7A, CT (RRP7A, Ribosomal RNA-processing protein 7 homolog A, Gastric cancer antigen Zg14) (Azide free) (HRP), 041287-HRP-200ul - For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Dilute required amount only prior to immediate use. Aliquots are stable at -20°c for 12 months after receipt. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. Applications suitable for use in western blot, elisa recommended dilution elisa 11,000 western blot 1100-500 storage and stability store product at 4°c if to be used immediately within two weeks. Note applications are based on unconjugated antibody. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c.


RRP1B NT RRP1B KIAA0179 Ribosomal RNA processing protein 1 homolog B RRP1-like protein B FITC 041286-FITC-200ul

RRP1B, NT (RRP1B, KIAA0179, Ribosomal RNA processing protein 1 homolog B, RRP1-like protein B) (FITC), 041286-FITC-200ul

RRP1B, NT (RRP1B, KIAA0179, Ribosomal RNA processing protein 1 homolog B, RRP1-like protein B) (FITC), 041286-FITC-200ul - Note applications are based on unconjugated antibody. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Applications suitable for use in western blot, flisa recommended dilution flisa 11,000 western blot 1100-500 storage and stability store product at 4°c if to be used immediately within two weeks. It may be a novel susceptibility gene for breast cancer progression and metastasis. Further dilutions can be made in assay buffer. Caution fitc conjugates are sensitive to light. Rrp1b belongs to the rrp1 family. Dilute required amount only prior to immediate use. Aliquots are stable at -20°c for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.


Recombinant Ribosomal RNA-processing protein 8 T07A98 Recombinant Protein

Recombinant Ribosomal RNA-processing protein 8 (T07A9.8) (Recombinant Protein)

Recombinant Ribosomal RNA-processing protein 8 (T07A9.8) (Recombinant Protein) - Source e coli or yeast or baculovirus or mammalian cell purity >90%. Synname homo sapiens d-tyrosyl-trna deacylase 1 homolog (s cerevisiae), mrna. Tag information his tagged (host tag may vary please inquire for specific tag information). Free-8gb-usbdrive for this item item is for research use not for diagnostic/therapeutic procedure. Species caenorhabditis elegans storage buffer tris-based buffer,50% glycerol. Genename dtd1 dueb hars2 pqn-68 c20orf88 ba379j53 ba555e181. Seqpos 1-343. Storage store at -20 degree c, for extended storage, conserve at -20 degree c or -80 degree c.


EXOSC4 ID EXOSC4 RRP41 SKI6 Exosome complex component RRP41 Exosome component 4 Ribosomal RNA-processing protein 41 p12A PE 035272-PE-200ul

EXOSC4, ID (EXOSC4, RRP41, SKI6, Exosome complex component RRP41, Exosome component 4, Ribosomal RNA-processing protein 41, p12A) (PE), 035272-PE-200ul

EXOSC4, ID (EXOSC4, RRP41, SKI6, Exosome complex component RRP41, Exosome component 4, Ribosomal RNA-processing protein 41, p12A) (PE), 035272-PE-200ul - Required for the 3′-processing of the 7s pre-rna to the mature 5. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Caution pe conjugates are sensitive to light. Plays a role in replication-dependent histone mrna degradation. Component of the exosome 3′->5′ exoribonuclease complex, a complex that degrades inherently unstable mrnas containing au-rich elements (ares) within their 3′-untranslated regions. Has a 3′-5′ exonuclease activity. Do not freeze stable at 4°c for 12 months after receipt as an undiluted liquid. Note applications are based on unconjugated antibody. Further dilutions can be made in assay buffer. Dilute required amount only prior to immediate use. Applications suitable for use in western blot, flisa recommended dilution flisa 11,000 western blot 1100-500 storage and stability store product at 4°c in the dark. 8s rrna.


RRP1 antibody N2C2 Internal - ribosomal RNA processing 1 homolog S cerevisiae 25 µL supplied

RRP1 antibody [N2C2], Internal – ribosomal RNA processing 1 homolog (S. cerevisiae), 25 µL supplied

RRP1 antibody [N2C2], Internal – ribosomal RNA processing 1 homolog (S. cerevisiae), 25 µL supplied - The protein encoded by this gene is the putative homolog of the yeast ribosomal rna processing protein rrp1. [Provided by refseq] keep as concentrated solution. Cerevisiae)). Avoid multiple freeze-thaw cycles. The encoded protein is involved in the late stages of nucleologenesis at the end of mitosis, and may be required for the generation of 28s rrna. Rabbit polyclonal antibody to rrp1 (ribosomal rna processing 1 homolog (s. Aliquot and store at -20ºc or below.

We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to and affiliated sites.