Best and Coolest 24 Morphogenesis in 2019

 

DAAM1 NT Disheveled-associated Activator Of Morphogenesis 1 DAAM1 KIAA0666 FITC D0875-01-FITC-200ul #ad

DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (FITC), D0875-01-FITC-200ul

DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (FITC), D0875-01-FITC-200ul #ad - Recommended dilution flisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Other applications not tested. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Light sensitive. Do not freeze fitc conjugates. Aliquots are stable for at least 6 months. Storage and stability may be stored at 4°c for short-term only. Aliquot to avoid repeated freezing and thawing. Applications suitable for use in flisa, western blot, and immunohistochemistry. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Note applications are based on unconjugated antibody.

 

ANTXR2 Anthrax Toxin Receptor 2 Capillary Morphogenesis Gene 2 Protein CMG-2 CMG2 FLJ31074 MGC111533 MGC45856 123348-50ug #ad

ANTXR2 (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, CMG2, FLJ31074, MGC111533, MGC45856), 123348-50ug

ANTXR2 (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, CMG2, FLJ31074, MGC111533, MGC45856), 123348-50ug #ad - For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Store at -20°c. Aliquots are stable for at least 12 months. Recommended dilution optimal dilutions to be determined by the researcher. Applications suitable for use in western blot. Aa sequence mvaersparspgswlfpglwllvlsgpggllraqeqpscrrafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrgkiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyaekeakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqscteilelqpssvcvgeefqivlsgrgfmlgsrngsvlctytvnetyttsvkpvsvqlnsmlcpapilnkagetldvsvsfnggksvisgslivtatecsngiaaiivilvlllllgiglmwwfwplcckvvikdpppppapapkeeeeeplptkkwptvdasyyggrgvggikrmevrwgdkgsteegarlekaknavvkipeeteepirprpprpkpthqppqtkwytpikgrldalwallrrqydrvslmrpqegdegrcinfsrvpsq storage and stability may be stored at 4°c for short-term only. Aliquot to avoid repeated freezing and thawing. Other applications not tested. Necessary for cellular interactions with laminin and the extracellular matrix.

 

DAAM1 CT Disheveled-associated Activator Of Morphogenesis 1 DAAM1 KIAA0666 Biotin D0875-01A-Biotin-200ul #ad

DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Biotin), D0875-01A-Biotin-200ul

DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Biotin), D0875-01A-Biotin-200ul #ad - Store at -20°c. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Note applications are based on unconjugated antibody. Aliquot to avoid repeated freezing and thawing. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Applications suitable for use in elisa, western blot, and immunohistochemistry. Aliquots are stable for at least 6 months. Storage and stability may be stored at 4°c for short-term only. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Other applications not tested. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity.

 

Dishevelled Associated Activator Of Morphogenesis 1 Antibody #ad

Dishevelled Associated Activator Of Morphogenesis 1 Antibody

Dishevelled Associated Activator Of Morphogenesis 1 Antibody #ad - Rabbit polyclonal, size 50 l more sizes available, please contact us on [email protected] for details. Reactivity human, mouse, rat. Free 8 gb usb flash drive with your order this product is for research use only. Rabbit polyclonal antibody against dishevelled associated activator of morphogenesis 1. Tested applications elisa, wb, ihc, if/icc.

 

DAAM1 NT Disheveled-associated Activator Of Morphogenesis 1 DAAM1 KIAA0666 PE D0875-01-PE-200ul #ad

DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (PE), D0875-01-PE-200ul

DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (PE), D0875-01-PE-200ul #ad - Storage and stability may be stored at 4°c before opening. Freezing r-phycoerythrin (pe) conjugates will result in a substantial loss of activity. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Recommended dilution flisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Stable for 12 months after receipt at 4°c. Dilute only prior to immediate use. Other applications not tested. Do not freeze stable at 4°c as an undiluted liquid. Applications suitable for use in flisa, western blot, and immunohistochemistry. Pe conjugates are sensitive to light. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. Note applications are based on unconjugated antibody.

 

DAAM1 NT Disheveled-associated Activator Of Morphogenesis 1 DAAM1 KIAA0666 Biotin D0875-01-Biotin-200ul #ad

DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Biotin), D0875-01-Biotin-200ul

DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Biotin), D0875-01-Biotin-200ul #ad - Aliquot to avoid repeated freezing and thawing. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Note applications are based on unconjugated antibody. Applications suitable for use in elisa, western blot, and immunohistochemistry. Storage and stability may be stored at 4°c for short-term only. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 6 months. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Store at -20°c. Other applications not tested. Recent evidence suggests a role for the formin homology (fh) proteins in these processes.

 

DAAM1-T361 NT DAAM1 KIAA0666 Disheveled-associated activator of morphogenesis 1 034453-200ul #ad

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1), 034453-200ul

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1), 034453-200ul #ad - The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Applications suitable for use in western blot, immunohistochemistry, flow cytometry, elisa recommended dilution elisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability may be stored at 4°c for short-term only. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Aliquot to avoid repeated freezing and thawing. Store at -20°c. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Aliquots are stable for 12 months.

 

DAAM2 NT Disheveled-associated Activator Of Morphogenesis 2 KIAA0381 Biotin D0875-02-Biotin-200ul #ad

DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Biotin), D0875-02-Biotin-200ul

DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Biotin), D0875-02-Biotin-200ul #ad - Applications suitable for use in elisa, western blot, and immunohistochemistry. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Store at -20°c. Daam2 is a 1068 amino acis protein belonging to the formin homology family. Note applications are based on unconjugated antibody. Other applications not tested. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Aliquots are stable for at least 6 months. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Storage and stability may be stored at 4°c for short-term only. Aliquot to avoid repeated freezing and thawing.

 

DAAM1 Disheveled-associated Activator Of Morphogenesis 1 KIAA0666 PE 125616-PE-100ul #ad

DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (PE), 125616-PE-100ul

DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (PE), 125616-PE-100ul #ad - Aa sequence maprkrggrgisfifccfrnndhpeityrlrndsnfalqtmepalpmppveeldvmfselvdeldltdkhreamfalpaekkwqiycskkkdqeenkgatswpefyidql. Recommended dilution optimal dilutions to be determined by the researcher. Applications suitable for use in elisa and western blot. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Other applications not tested.

 

DAAM1 CT Disheveled-associated Activator Of Morphogenesis 1 DAAM1 KIAA0666 FITC D0875-01A-FITC-200ul #ad

DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (FITC), D0875-01A-FITC-200ul

DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (FITC), D0875-01A-FITC-200ul #ad - Aliquot to avoid repeated freezing and thawing. Do not freeze fitc conjugates. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Applications suitable for use in flisa, western blot, and immunohistochemistry. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Aliquots are stable for at least 6 months. Other applications not tested. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Note applications are based on unconjugated antibody. Recommended dilution flisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Storage and stability may be stored at 4°c for short-term only. Light sensitive.

 

DAAM2 NT Disheveled-associated Activator Of Morphogenesis 2 KIAA0381 AP D0875-02-AP-200ul #ad

DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (AP), D0875-02-AP-200ul

DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (AP), D0875-02-AP-200ul #ad - It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Other applications not tested. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Applications suitable for use in elisa, western blot, and immunohistochemistry. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Note applications are based on unconjugated antibody. Light sensitive. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Daam2 is a 1068 amino acis protein belonging to the formin homology family. Aliquots are stable for at least 6 months. Do not freeze alkaline phosphatase conjugates which could result in a substantial loss of enzymatic activity. Storage and stability may be stored at 4°c for short-term only.

 

DAAM1-T361 NT DAAM1 KIAA0666 Disheveled-associated activator of morphogenesis 1 Azide free HRP 034453-HRP-200ul #ad

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (Azide free) (HRP), 034453-HRP-200ul

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (Azide free) (HRP), 034453-HRP-200ul #ad - Aliquots are stable at -20°c for 12 months after receipt. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. Applications suitable for use in western blot, immunohistochemistry elisa recommended dilution elisa 11,000 western blot 1100-500 immunohistochemistry 150-100 storage and stability store product at 4°c if to be used immediately within two weeks. Further dilutions can be made in assay buffer. The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Dilute required amount only prior to immediate use. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note applications are based on unconjugated antibody.

 

DAAM2 Disheveled-associated Activator Of Morphogenesis 2 KIAA0381 PE 125617-PE-100ul #ad

DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (PE), 125617-PE-100ul

DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (PE), 125617-PE-100ul #ad - It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Recommended dilution optimal dilutions to be determined by the researcher. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Aa sequence maprkrshhglgflccfggsdipeinlrdnhplqfmefsspipnaeelnirfaelvdeldltdknreamfalppekkwqiycskkkvpsltplatsqgswhgvalaalacscihlmfitcqpcsrcwrnnse. Daam2 is a 1068aa protein belonging to the formin homology family. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Other applications not tested. Applications suitable for use in western blot.

 

DAAM2 Disheveled-associated Activator Of Morphogenesis 2 KIAA0381 Biotin 125617-Biotin-100ul #ad

DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Biotin), 125617-Biotin-100ul

DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Biotin), 125617-Biotin-100ul #ad - Daam2 is a 1068aa protein belonging to the formin homology family. Aa sequence maprkrshhglgflccfggsdipeinlrdnhplqfmefsspipnaeelnirfaelvdeldltdknreamfalppekkwqiycskkkvpsltplatsqgswhgvalaalacscihlmfitcqpcsrcwrnnse. Recommended dilution optimal dilutions to be determined by the researcher. Applications suitable for use in western blot. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Other applications not tested.

 

DAAM1-T361 NT DAAM1 KIAA0666 Disheveled-associated activator of morphogenesis 1 Biotin 034453-Biotin-200ul #ad

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (Biotin), 034453-Biotin-200ul

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (Biotin), 034453-Biotin-200ul #ad - Dilute required amount only prior to immediate use. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Note applications are based on unconjugated antibody. Further dilutions can be made in assay buffer. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Applications suitable for use in western blot, immunohistochemistry, flow cytometry, elisa recommended dilution elisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability store product at 4°c if to be used immediately within two weeks. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Aliquots are stable at -20°c for 12 months after receipt.

 

Recombinant Bacillus phage PZA Morphogenesis protein 1 13 Recombinant Protein #ad

Recombinant Bacillus phage PZA Morphogenesis protein 1 (13) (Recombinant Protein)

Recombinant Bacillus phage PZA Morphogenesis protein 1 (13) (Recombinant Protein) #ad - Probable metalloendopeptidase (ec34–). Genename 13. Species bacillus phage pza (bacteriophage pza) storage buffer tris-based buffer,50% glycerol. Late protein gp13including the following 2 domainslysozyme-like glycosidase (ec321-). Free-8gb-usbdrive for this item item is for research use not for diagnostic/therapeutic procedure. Synname morphogenesis protein 1. Storage store at -20 degree c, for extended storage, conserve at -20 degree c or -80 degree c. Seqpos 1-365.

 

DAAM2 NT Disheveled-associated Activator Of Morphogenesis 2 KIAA0381 Azide free HRP D0875-02-HRP-200ul #ad

DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Azide free) (HRP), D0875-02-HRP-200ul

DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Azide free) (HRP), D0875-02-HRP-200ul #ad - Daam2 is a 1068 amino acis protein belonging to the formin homology family. Other applications not tested. Storage and stability store product at 4°c if to be used immediately within two weeks. Applications suitable for use in elisa, western blot, and immunohistochemistry. Aliquots are stable at -20°c for 12 months after receipt. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Dilute required amount only prior to immediate use. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note applications are based on unconjugated antibody. Further dilutions can be made in assay buffer. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher.

 

DAAM1 Disheveled-associated Activator Of Morphogenesis 1 KIAA0666 HRP 125616-HRP-100ul #ad

DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (HRP), 125616-HRP-100ul

DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (HRP), 125616-HRP-100ul #ad - Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Aa sequence maprkrggrgisfifccfrnndhpeityrlrndsnfalqtmepalpmppveeldvmfselvdeldltdkhreamfalpaekkwqiycskkkdqeenkgatswpefyidql. Other applications not tested. Applications suitable for use in elisa and western blot. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Recommended dilution optimal dilutions to be determined by the researcher.

 

DAAM1 CT Disheveled-associated Activator Of Morphogenesis 1 DAAM1 KIAA0666 Azide free HRP D0875-01A-HRP-200ul #ad

DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Azide free) (HRP), D0875-01A-HRP-200ul

DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Azide free) (HRP), D0875-01A-HRP-200ul #ad - Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Aliquots are stable at -20°c for 12 months after receipt. Dilute required amount only prior to immediate use. Other applications not tested. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. Storage and stability store product at 4°c if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Applications suitable for use in elisa, western blot, and immunohistochemistry. Note applications are based on unconjugated antibody. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher.

 

DAAM2 Disheveled-associated Activator Of Morphogenesis 2 KIAA0381 HRP 125617-HRP-100ul #ad

DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (HRP), 125617-HRP-100ul

DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (HRP), 125617-HRP-100ul #ad - Other applications not tested. Daam2 is a 1068aa protein belonging to the formin homology family. Aa sequence maprkrshhglgflccfggsdipeinlrdnhplqfmefsspipnaeelnirfaelvdeldltdknreamfalppekkwqiycskkkvpsltplatsqgswhgvalaalacscihlmfitcqpcsrcwrnnse. Recommended dilution optimal dilutions to be determined by the researcher. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Applications suitable for use in western blot.

 

FRMPD4 ID FERM and PDZ Domain-containing Protein 4 PDZ Domain-containing Protein 10 PSD-95-interacting Regulator of Spine Morphogenesis Preso KIAA0316 PDZD10 PDZK10 F6076-34-50ug #ad

FRMPD4, ID (FERM and PDZ Domain-containing Protein 4, PDZ Domain-containing Protein 10, PSD-95-interacting Regulator of Spine Morphogenesis, Preso, KIAA0316, PDZD10, PDZK10), F6076-34-50ug

FRMPD4, ID (FERM and PDZ Domain-containing Protein 4, PDZ Domain-containing Protein 10, PSD-95-interacting Regulator of Spine Morphogenesis, Preso, KIAA0316, PDZD10, PDZK10), F6076-34-50ug #ad - Required for the maintenance of excitatory synaptic transmission. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Storage and stability may be stored at 4°c for short-term only. Recommended dilution western blot 1-2ug/ml immunohistochemistry (formalin fixed paraffin embedded) 5ug/ml optimal dilutions to be determined by the researcher. Applications suitable for use in elisa, western blot and immunohistochemistry. Store at -20°c. Binds phosphatidylinositol-4,5-bisphosphate. Aliquots are stable for at least 12 months. Aliquot to avoid repeated freezing and thawing. Positive regulator of dendritic spine morphogenesis and density. Other applications not tested.

 

DAAM1-T361 NT DAAM1 KIAA0666 Disheveled-associated activator of morphogenesis 1 FITC 034453-FITC-200ul #ad

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (FITC), 034453-FITC-200ul

DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (FITC), 034453-FITC-200ul #ad - Further dilutions can be made in assay buffer. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Note applications are based on unconjugated antibody. Aliquots are stable at -20°c for 12 months after receipt. Applications suitable for use in western blot, immunohistochemistry, flow cytometry, flisa recommended dilution flisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability store product at 4°c if to be used immediately within two weeks. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Dilute required amount only prior to immediate use. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Caution fitc conjugates are sensitive to light. The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development.

 

FRMPD4 FERM and PDZ Domain-containing Protein 4 PDZ Domain-containing Protein 10 PSD-95-interacting Regulator of Spine Morphogenesis Preso KIAA0316 PDZD10 PDZK10 146539-100ug #ad

FRMPD4 (FERM and PDZ Domain-containing Protein 4, PDZ Domain-containing Protein 10, PSD-95-interacting Regulator of Spine Morphogenesis, Preso, KIAA0316, PDZD10, PDZK10), 146539-100ug

FRMPD4 (FERM and PDZ Domain-containing Protein 4, PDZ Domain-containing Protein 10, PSD-95-interacting Regulator of Spine Morphogenesis, Preso, KIAA0316, PDZD10, PDZK10), 146539-100ug #ad - The decreased level of frmpd4 also resulted in reduced levels of excitatory synaptic transmission, suggesting that frmpd4 is required for maintenance of excitatory synaptic transmission. Positive control sk-n-sh cell lysate storage and stability may be stored at 4°c for short-term only. Overexpression of frmpd4 in cultured hippocampal neurons significantly increased the linear density of dendritic spines without changing their length and width conversely, knockdown experiments using rnai caused a decrease in spine density, indicating frmpd4 positively regulates dendritic spine density but not morphology. Frmpd4, also known as preso, also contains another protein interaction domain termed ww (domain with two conserved trp residues) at its amino terminus. Aliquots are stable for at least 12 months. It was identified through a yeast two-hybrid screen using the pdz domain of psd-95 as bait and is highly expressed in multiple regions of the brain and is enriched in the postsynaptic density (psd) fractions. Applications suitable for use in elisa, western blot, immunofluorescence and immunohistochemistry. Aliquot to avoid repeated freezing and thawing. Other applications not tested. Store at -20°c. Recommended dilution western blot 1-2ug/ml immunohistochemistry (formalin fixed paraffin embedded) 5ug/ml optimal dilutions to be determined by the researcher. The ferm and pdz domain containing (frmpd) protein family consists of four proteins that contain a ferm (four-point-one, erzin, radixin, moesin) domain and at least one pdz (psd-95/discs large/zonula-occuldens-1) domain. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

 

CMG2 ID Anthrax Toxin Receptor 2 Capillary Morphogenesis Gene 2 Protein CMG-2 ANTXR2 C1077-45B-50ug #ad

CMG2, ID (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, ANTXR2), C1077-45B-50ug

CMG2, ID (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, ANTXR2), C1077-45B-50ug #ad - 5ug/ml optimal dilutions to be determined by the researcher. Cmg-2, also known as anthrax toxin receptor 2 (antxr2) is a 45kd type i membrane protein with a von willebrand factor a/integrin-like inserted domain in its extracellular region. It also interacts with the protective antigen (pa) subunit of anthrax toxin. Aliquots are stable for at least 12 months. 3-1ug/ml immunohistochemistry (formalin fixed paraffin embedded) 2. Cmg-2 binds laminin and collagen type iv. Other applications not tested. Recommended dilution elisa 116,000 western blot 0. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Applications suitable for use in elisa, western blot and immunohistochemistry. Storage and stability may be stored at 4°c for short-term only. Store at -20°c.





We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to Amazon.com and affiliated sites.